518-831-8000 sales@utechproducts.com

Mtr Antibody Blocking Peptide, Highly Purified. Generating Reliable And Reproducible Results. Applications: Antibody Competition, Each

$ 294.98

Details

A blocking peptide from human mtr. Source: synthetic amino acid sequence: (accession #: np_000245) gseqldvadlrrlrykgirpapgypsqpdhtekltmwrladieqstgirl. The mtr blocking peptide is derived from synthetic. The mtr blocking peptide has been validated for the following applications: antibody competition.

Additional Information

SKU 10177848
UOM Each
UNSPSC 41105906
Manufacturer Part Number NBP179285PEP