Mtr Antibody Blocking Peptide, Highly Purified. Generating Reliable And Reproducible Results. Applications: Antibody Competition, Each
$ 294.98
|
|
Details:
A blocking peptide from human MTR. Source: Synthetic Amino Acid Sequence: (Accession #: NP_000245) GSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL. The MTR Blocking Peptide is derived from Synthetic. The MTR Blocking Peptide has been validated for the following applications: Antibody Competition.
Additional Information
| SKU | 10177848 |
|---|---|
| UOM | Each |
| UNSPSC | 41105906 |
| Manufacturer Part Number | NBP179285PEP |
