518-831-8000 sales@utechproducts.com

Zdhhc21 Antibody Blocking Peptide, Highly Purified. Generating Reliable And Reproducible Results. Applications: Antibody Competition, Each

294.98

Details:

A blocking peptide from human zdhhc21. Source: synthetic amino acid sequence: (accession #: np_848661)elltcyalmfsfchyyyflplkkrnldlfvfrhelaimrlaafmgitmlv. The zdhhc21 blocking peptide is derived from synthetic. The zdhhc21 blocking peptide has been validated for the following applications: antibody competition.

Additional Information

SKU 10177846
UOM Each
UNSPSC 41105906
Manufacturer Part Number NBP157049PEP