518-831-8000 sales@utechproducts.com

NPPC Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant NPPC, Each

1,757.70

Details:

Natriuretic peptides comprise a family of 3 structurally related molecules: atrial natriuretic peptide (ANP; MIM 108780), brain natriuretic peptide (BNP; MIM 600295), and C-type natriuretic peptide, CNP, encoded by a gene symbolized NPPC. These peptides possess potent natriuretic, diuretic, and vasodilating activities and are implicated in body fluid homeostasis and blood pressure control.[supplied by OMIMSequence: PKVPRTPPAEELAEPQAAGGGQKKGDKAPGGGGANLKGDRSRLLRDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC

Additional Information

SKU 10288873
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22868