518-831-8000 sales@utechproducts.com

Ofd1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ofd1, Each

$ 1,757.70

Details

This gene is located on the x chromosome and encodes a centrosomal protein. A knockout mouse model has been used to study the effect of mutations in this gene. The mouse gene is also located on the x chromosome, however, unlike the human gene it is not subject to x inactivation. Mutations in this gene are associated with oral-facial-digital syndrome type i and simpson-golabi-behmel syndrome type 2. Many pseudogenes have been identified; a single pseudogene is found on chromosome 5 while as many as fifteen have been found on the y chromosome. Alternatively spliced transcripts have been described for this gene but the biological validity of these transcripts has not been determined. [Provided by refseqsequence: sfeetydrklknellkyqlelkddyiirtnrliederknkekavhlqeeliainskkeelnqsvnrvkelelelesvkaqslaitkqnh

Additional Information

SKU 10288791
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22774