518-831-8000 sales@utechproducts.com

OTOR, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant OTOR, Each

1,757.70

Details:

The protein encoded by this gene is secreted via the Golgi apparatus and may function in cartilage development and maintenance. A frequent polymorphism in the translation start codon of this gene can abolish translation and may be associated with forms of deafness. This gene is a member of the melanoma-inhibiting activity gene family. In addition, alternate polyA sites exist for this gene. [provided by RefSeqSequence: RLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE

Additional Information

SKU 10287857
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21682