518-831-8000 sales@utechproducts.com

Pcdh17, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Pcdh17, Each

$ 1,757.70

Details

This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The encoded protein contains six extracellular cadherin domains, a transmembrane domain, and a cytoplasmic tail differing from those of the classical cadherins. The encoded protein may play a role in the establishment and function of specific cell-cell connections in the brain. [Provided by refseqsequence: vndnapvivlptlqndtaelqvprnaglgylvstvraldsdfgesgrltyeivdgnddhlfeidpssgeirtlhpfwedvtpvvelvvkvtdhgkptlsavakliirsvsgslpegvprvngeqhhwd

Additional Information

SKU 10287999
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21840