518-831-8000 sales@utechproducts.com

Pcnt Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Pcnt, Each

$ 1,757.70

Details

The protein encoded by this gene binds to calmodulin and is expressed in the centrosome. It is an integral component of the pericentriolar material (pcm). The protein contains a series of coiled-coil domains and a highly conserved pcm targeting motif called the pact domain near its c-terminus. The protein interacts with the microtubule nucleation component gamma-tubulin and is likely important to normal functioning of the centrosomes, cytoskeleton, and cell-cycle progression. Mutations in this gene cause seckel syndrome-4 and microcephalic osteodysplastic primordial dwarfism type ii. [Provided by refseqsequence: mldlsswsspevlrkdwtlepwpslpvtphsgalslcsadtslgdradtslpqtqgpgllcspgvsaaalalqwaesppaddhhvqrtavekdvedfittsfdsqetlsspppglegkadrseksdgsg

Additional Information

SKU 10287473
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21254