PCTK1 Rabbit anti-Human, Mouse, Rat, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant PCTK1, Each
$ 1,757.70
|
|
Details:
The protein encoded by this gene belongs to the cdc2/cdkx subfamily of the ser/thr family of protein kinases. It may play a role in signal transduction cascades in terminally differentiated cells. This gene is thought to escape X inactivation. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeqSequence: MDRMKKIKRQLSMTLRGGRGIDKTNGAPEQIGLDESGGGGGSDPGEAPTRAAPGELRSARGPLSSAPEIVHEDLKMGSDGESDQASATSSDEVQSPVRVRMRNHPPRKISTEDINKRLSLPAD
Additional Information
| SKU | 10292304 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28420 |
