518-831-8000 sales@utechproducts.com

PDSS1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant PDSS1, Each

1,757.70

Details:

The protein encoded by this gene is an enzyme that elongates the prenyl side-chain of coenzyme Q, or ubiquinone, one of the key elements in the respiratory chain. The gene product catalyzes the formation of all trans-polyprenyl pyrophosphates from isopentyl diphosphate in the assembly of polyisoprenoid side chains, the first step in coenzyme Q biosynthesis. The protein may be peripherally associated with the inner mitochondrial membrane, though no transit peptide has been definitively identified to date. Defects in this gene are a cause of coenzyme Q10 deficiency. [provided by RefSeqSequence: MGKPTSADLKLGLATGPVLFACQQFPEMNAMIMRRFSLPGDVDRARQYVLQSDGVQQTTYLAQQYCHEAIREISKLRPSPERDALIQLSEIVLT

Additional Information

SKU 10289160
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23207