PEBP4, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant PEBP4, Each
$ 1,069.20
|
|
Details:
The phosphatidylethanolamine (PE)-binding proteins, including PEBP4, are an evolutionarily conserved family of proteins with pivotal biologic functions, such as lipid binding and inhibition of serine proteases (Wang et al., 2004 [PubMed 15302887]).[supplied by OMIMSequence: EGKVISLLPKENKTRGSWKMDRFLNRFHLGEPEASTQFMTQNYQDSPTLQAPRERASEPKHK
Additional Information
| SKU | 10287927 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21759 |
