PIGX, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant PIGX, Each
$ 1,069.20
|
|
Details:
Glycosylphosphatidylinositol (GPI) is a complex glycolipid that anchors many proteins to the cell surface. PIGX is a subunit of a GPI mannosyltransferase complex involved in the synthesis of the core GPI structure in the endoplasmic reticulum (ER) (Ashida et al., 2005 [PubMed 15635094]).[supplied by OMIMSequence: MCSEIILRQEVLKDGFHRDLLIKVKFGESIEDLHTCRLLIKQDIPAGLYVDPYELASLRERNITEAVMVSENFDIEAPNYLSKESEVLIYARRDSQCIDCFQAFLPVHCRYHRPHSEDGEASIVVNNPDLLMFCD
Additional Information
| SKU | 10288372 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22284 |
