518-831-8000 sales@utechproducts.com

Plod3, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Plod3, Each

$ 1,757.70

Details

The protein encoded by this gene is a membrane-bound homodimeric enzyme that is localized to the cisternae of the rough endoplasmic reticulum. The enzyme (cofactors iron and ascorbate) catalyzes the hydroxylation of lysyl residues in collagen-like peptides. The resultant hydroxylysyl groups are attachment sites for carbohydrates in collagen and thus are critical for the stability of intermolecular crosslinks. Some patients with ehlers-danlos syndrome type vib have deficiencies in lysyl hydroxylase activity. [Provided by refseqsequence: fdrnrvrirnvaydtlpivvhgngptklqlnylgnyvpngwtpeggcgfcnqdrrtlpggqppprvflavfveqptpflprflqrlllldyppdrvtlflhnnevfhephiadswpqlqdhfsavklvgpeeal

Additional Information

SKU 10292287
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28401