518-831-8000 sales@utechproducts.com

Pofut2 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Pofut2, Each

$ 1,757.70

Details

Fucose is typically found as a terminal modification of branched chain glycoconjugates, but it also exists in direct o-linkage to serine or threonine residues within cystine knot motifs in epidermal growth factor (egf; mim 131530)-like repeats or thrombospondin (thbs; see mim 188060) type-1 repeats. Pofut2 is an o-fucosyltransferase that use thbs type-1 repeats as substrates (luo et al., 2006 [Pubmed 16464857]).[Supplied by omimsequence: pegfnlrrdvyiriasllktllkteewvlvlppwgrlyhwqspdihqvripwseffdlpslnknipvieyeqfiaesggpfidqvyvlqsyaegwkegtweekvderpcidqlly

Additional Information

SKU 10292183
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28284