POLDIP3, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant POLDIP3, Each
$ 1,069.20
|
|
Details
This gene encodes a protein that interacts with the DNA polymerase delta p50 subunit. This protein is a specific target of S6 kinase 1 and regulates cell growth. Two transcript variants that encode different protein isoforms have been identified. [provided by RefSeqSequence: SLDELIRKRGAAAKGRLNARPGVGGVRSRVGIQQGLLSQSTRTATFQQRFDARQKIGLSDARLKLGVKDAREKLLQKDARFRIKGKVQDAR
Additional Information
| SKU | 10287396 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21164 |
Loading Cart Data 