518-831-8000 sales@utechproducts.com

Ppm2c Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ppm2c, Each

$ 1,757.70

Details

Pyruvate dehydrogenase (e1) is one of the three components (e1, e2, and e3) of the large pyruvate dehydrogenase complex. Pyruvate dehydrogenase kinases catalyze phosphorylation of serine residues of e1 to inactivate the e1 component and inhibit the complex. Pyruvate dehydrogenase phosphatases catalyze the dephosphorylation and activation of the e1 component to reverse the effects of pyruvate dehydrogenase kinases. Pyruvate dehydrogenase phosphatase is a heterodimer consisting of catalytic and regulatory subunits. Two catalytic subunits have been reported; one is predominantly expressed in skeletal muscle and another one is is much more abundant in the liver. The catalytic subunit, encoded by this gene, is the former, and belongs to the protein phosphatase 2c (pp2c) superfamily. Along with the pyruvate dehydrogenase complex and pyruvate dehydrogenase kinases, this enzyme is located in the mitochondrial matrix. Mutation in this gene causes pyruvate dehydrogenase phosphatase deficiency. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.[Provided by refseqsequence: yltppqvnsilkaneysfkvpefdgknvssilgfdsnqlpanapiedrrsaatclqtrgmllgvfdghagcacsq

Additional Information

SKU 10287282
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21039