PRICKLE3, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant PRICKLE3, Each
$ 1,750.95
|
|
Details:
LIM domain only 6 is a three LIM domain-containing protein. The LIM domain is a cysteine-rich sequence motif that binds zinc atoms to form a specific protein-binding interface for protein-protein interactions. [provided by RefSeqSequence: LIFCSRACSLGSEPTAPGPSRRSWSAGPVTAPLAASTASFSAVKGASETTTKGTSTELAPATGPEEPSRFLRGAPHRHSMPELGLRSVPEPPPESPGQPNLRPDDSAFGRQS
Additional Information
| SKU | 10286402 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20027 |
