518-831-8000 sales@utechproducts.com

PTS, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant PTS, Each

1,757.70

Details:

The enzyme encoded by this gene catalyzes the elimination of inorganic triphosphate from dihydroneopterin triphosphate, which is the second and irreversible step in the biosynthesis of tetrahydrobiopterin from GTP. Tetrahydrobiopterin, also known as BH(4), is an essential cofactor and regulator of various enzyme activities, including enzymes involved in serotonin biosynthesis and NO synthase activity. Mutations in this gene result in hyperphenylalaninemia. [provided by RefSeqSequence: RCQAQVSRRISFSASHRLYSKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPATGMVMNLADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYIWDNLQKVLPVGVLYKVKVYETDNNIV

Additional Information

SKU 10292322
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28440