QRFP, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant QRFP, Each

$ 1,069.20
|
Details
The P518 precursor protein can be processed into several RF (arg-phe)-amide peptides, including P518. RF-amide peptides share a common C-terminal motif and are involved in cell signaling through G protein-coupled receptors (Jiang et al., 2003 [PubMed 12714592]).[supplied by OMIMSequence: GREHAGCRFRFGRQDEGSEATGFLPAAGEKTSGPLGNLAEELNGYSRKKGGFSFR
Additional Information
SKU | 10292043 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB28115 |