518-831-8000 sales@utechproducts.com

RAB3GAP2 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant RAB3GAP2, Each

1,757.70

Details:

Members of the RAB3 protein family (see RAB3A; MIM 179490) are implicated in Ca(2 )-dependent exocytosis. RAB3GAP, which is involved in regulation of RAB3 activity, is a heterodimeric complex consisting a 130kDa catalytic subunit (RAB3GAP1; MIM 602536) and a 150kDa noncatalytic subunit (RAB3GAP2) (Nagano et al., 1998 [PubMed 9733780]).[supplied by OMIMSequence: TYEIPRHPGVTEQNEELSILYPAAIVTIDGFSLFQSLRACRNQVAKAAASGNENIQPPPLAYKKWGLQDIDTIIDHASVGIMTLSPFDQMKTA

Additional Information

SKU 10287960
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21794