RAB3GAP2 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant RAB3GAP2, Each
$ 1,069.20
|
|
Details:
Members of the RAB3 protein family (see RAB3A; MIM 179490) are implicated in Ca(2 )-dependent exocytosis. RAB3GAP, which is involved in regulation of RAB3 activity, is a heterodimeric complex consisting a 130kDa catalytic subunit (RAB3GAP1; MIM 602536) and a 150kDa noncatalytic subunit (RAB3GAP2) (Nagano et al., 1998 [PubMed 9733780]).[supplied by OMIMSequence: EHHSILCSILYAVMRFSLKTVKPLSLFDSKGKNAFFKDLTSIQLLPSGEMDPNFISVRQQFLLKVVSAAVQAQHSATKVKDPT
Additional Information
| SKU | 10288040 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21889 |
