518-831-8000 sales@utechproducts.com

RAD54B, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant RAD54B, Each

1,069.20

Details

The protein encoded by this gene belongs to the DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA. This protein binds to double-stranded DNA, and displays ATPase activity in the presence of DNA. This gene is highly expressed in testis and spleen, which suggests active roles in meiotic and mitotic recombination. Homozygous mutations of this gene were observed in primary lymphoma and colon cancer. [provided by RefSeqSequence: SNISEPTKKVMEMIPQISSFCLVRDRNHIQSANLDEEAQAGTSSLQVMLDHHPVAITVEVKQEEDIKPPPPLVLNSQQSDTLEQREEHELVHVMERSLSP

Additional Information

SKU 10288113
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21975