RBM15B, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant RBM15B, Each
$ 1,069.20
|
|
Details:
Members of the SPEN (Split-end) family of proteins, including RBM15B, have repressor function in several signaling pathways and may bind to RNA through interaction with spliceosome components (Hiriart et al., 2005 [PubMed 16129689]).[supplied by OMIMSequence: GKKARDSERNHRTTEAEPKPLEEPKHETKKLKNLSEYAQTLQLGWNGLLVLKNSCFPTSMHILEGDQGVISSLLKDHTSG
Additional Information
| SKU | 10289017 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23043 |
