518-831-8000 sales@utechproducts.com

RDBP, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant RDBP, Each

1,069.20

Details

The protein encoded by this gene is part of a complex termed negative elongation factor (NELF) which represses RNA polymerase II transcript elongation. This protein bears similarity to nuclear RNA-binding proteins; however, it has not been demonstrated that this protein binds RNA. The protein contains a tract of alternating basic and acidic residues, largely arginine (R) and aspartic acid (D). The gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. [provided by RefSeqSequence: LLALKKQSSSSTTSQGGVKRSLSEQPVMDTATATEQAKQLVKSGAISAIKAETKNSGFKRSRTLEGKLKDPEKGPVPTFQPFQRSISADDDLQESSRRPQRKSLYESFVSSSDRLRELGPDG

Additional Information

SKU 10286700
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20363