518-831-8000 sales@utechproducts.com

Rnf43, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Rnf43, Each

$ 1,757.70

Details

Rnf43 is a hap95 (akap8l; mim 609475) binding ubiquitin ligase that promotes cell growth and is upregulated in colon cancer (yagyu et al., 2004 [Pubmed 15492824]; sugiura et al., 2008 [Pubmed 18313049]).[Supplied by omimsequence: cvdpwlhqhrtcplcmfnitegdsfsqslgpsrsyqepgrrlhlirqhpghahyhlpaayllgpsrsavarpprpgpflpsqepgmgprhhrfpraahprapgeqqrlagaqhpyaqgwglshlqstsqh

Additional Information

SKU 10286741
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20409