518-831-8000 sales@utechproducts.com

RNF44, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant RNF44, Each

1,069.20

Details:

The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. [provided by RefSeqSequence: MRPWALAVTRWPPSAPVGQRRFSAGPGSTPGQLWGSPGLEGPLASPPARDERLPSQQPPSRPPHLPVEERRASAPAGGSPRMLHPATQ

Additional Information

SKU 10289307
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23378