518-831-8000 sales@utechproducts.com

RP9, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant RP9, Each

1,757.70

Details:

The protein encoded by this gene can be bound and phosphorylated by the protooncogene PIM1 product, a serine/threonine protein kinase . This protein localizes in nuclear speckles containing the splicing factors, and has a role in pre-mRNA splicing. CBF1-interacting protein (CIR), a corepressor of CBF1, can also bind to this protein and effects alternative splicing. Mutations in this gene result in autosomal dominant retinitis pigmentosa-9. This gene has a pseudogene (GeneID: 441212), which is located in tandem array approximately 166kb distal to this gene. [provided by RefSeqSequence: PEQELQRRREQKRRRHDAQQLQQLKHLESFYEKPPPGLIKEDETKPEDCIPDVPGNEHAREFLAHAPTKGLWM

Additional Information

SKU 10288608
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22562