518-831-8000 sales@utechproducts.com

Rshl3 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Rshl3, Each

$ 1,757.70

Details

This gene encodes a protein that appears to be a component the radial spoke head, as determined by homology to similar proteins in the biflagellate alga chlamydomonas reinhardtii and other ciliates. Radial spokes, which are regularly spaced along cilia, sperm, and flagella axonemes, consist of a thin 'stalk' and a bulbous 'head' that form a signal transduction scaffold between the central pair of microtubules and dynein. Mutations in this gene cause primary ciliary dyskinesia 1, a disease arising from dysmotility of motile cilia and sperm. Alternative splicing results in multiple transcript variants. [Provided by refseqsequence: rpwegktaaspqysepessepleakqgpetgrqsrssrpwspqsraktplggpagpetsspapvsprepsssp

Additional Information

SKU 10288578
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22526