518-831-8000 sales@utechproducts.com

Rspo1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Rspo1, Each

$ 1,757.70

Details

This gene is a member of the r-spondin family and encodes a secreted activator protein with two cystein-rich, furin-like domains and one thrombospondin type 1 domain. In mice, the protein induces the rapid onset of crypt cell proliferation and increases intestinal epithelial healing, providing a protective effect against chemotherapy-induced adverse effects. [Provided by refseqsequence: ckeglylhkgrcypacpegssaangtmecsspaqcemsewspwgpcskkqqlcgfrrgseertrrvlha

Additional Information

SKU 10292122
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28202