518-831-8000 sales@utechproducts.com

S100a12 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant S100a12, Each

$ 1,757.70

Details

The protein encoded by this gene is a member of the s100 family of proteins containing 2 ef-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein is proposed to be involved in specific calcium-dependent signal transduction pathways and its regulatory effect on cytoskeletal components may modulate various neutrophil activities. [Provided by refseqsequence: kleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqgldanqdeqvdfqefislvaialkaahyhthke

Additional Information

SKU 10292536
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28697