518-831-8000 sales@utechproducts.com

Sage1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Sage1, Each

$ 1,757.70

Details

This gene belongs to a class of genes that are activated in tumors. These genes are expressed in tumors of different histologic types but not in normal tissues, except for spermatogenic cells and, for some, placenta. The proteins encoded by these genes appear to be strictly tumor specific, and hence may be excellent sources of antigens for cancer immunotherapy. This gene is expressed in sarcomas. [Provided by refseqsequence: hsvreekmesgkpqtdkvisndapqlghmaaggipsmstkdlyatvtqnvheermennqpqpsydlstvlpgltyltvagipamstrdqyatvthnvheekikngqaasdnvfstvppafinmaatgvssmstrdqyaavthnir

Additional Information

SKU 10292553
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28717