518-831-8000 sales@utechproducts.com

Sash3, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Sash3, Each

$ 1,750.95

Details

The protein encoded by this gene contains a src homology-3 (sh3) domain and a sterile alpha motif (sam), both of which are found in proteins involved in cell signaling. This protein may function as a signaling adapter protein in lymphocytessequence: pktlhellerigleehtstlllngyqtledfkelrethlnelnimdpqhraklltaaellldydtgseeaeegaessqepvahtvsepkvdiprdsgcfegsesgrddaelagteeqlqglsl

Additional Information

SKU 10286406
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20031