518-831-8000 sales@utechproducts.com

SDHB, subunit B, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SDHB, subunit B, Each

1,069.20

Details

Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The iron-sulfur subunit is highly conserved and contains three cysteine-rich clusters which may comprise the iron-sulfur centers of the enzyme. Sporadic and familial mutations in this gene result in paragangliomas and pheochromocytoma, and support a link between mitochondrial dysfunction and tumorigenesis. [provided by RefSeqSequence: EGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATY

Additional Information

SKU 10292535
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28696