518-831-8000 sales@utechproducts.com

SDHB, subunit B, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SDHB, subunit B, Each

1,069.20

Details:

Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The iron-sulfur subunit is highly conserved and contains three cysteine-rich clusters which may comprise the iron-sulfur centers of the enzyme. Sporadic and familial mutations in this gene result in paragangliomas and pheochromocytoma, and support a link between mitochondrial dysfunction and tumorigenesis. [provided by RefSeqSequence: EGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATY

Additional Information

SKU 10292535
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28696