SEC31B Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SEC31B, Each

$ 1,069.20
|
Details
This gene encodes a protein of unknown function. The protein has moderate similarity to rat VAP1 protein which is an endosomal membrane-associated protein, containing a putative Ca2 /calmodulin-dependent kinase II phosphorylation site. [provided by RefSeqSequence: ATWLKSDVGLGESPQPKGNDLNSDRQQAFCSQASKHTTKEASASSAFFDELVPQNMTPWEIPITKDIDGLLSQALLLGELG
Additional Information
SKU | 10289592 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB23700 |