518-831-8000 sales@utechproducts.com

SLAMF9 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SLAMF9, Each

1,331.55

Details:

This gene encodes a member of the signaling lymphocytic activation molecule family. The encoded protein is a cell surface molecule that consists of two extracellular immunoglobulin domains, a transmembrane domain and a short cytoplasmic tail that lacks the signal transduction motifs found in other family members. Alternative splicing results in multiple transcript variantsSequence: TYSWLSRGDSTYTFHEGPVLSTSWRPGDSALSYTCRANNPISNVSSCPIPDGPFYADPNYASEKPSTAF

Additional Information

SKU 10288863
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22856