SLC25A22, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SLC25A22, Each
$ 1,069.20
|
|
Details:
The SLC25 gene family encodes mitochondrial carriers that transport a variety of metabolites across the inner mitochondrial membrane (Palmieri, 2004 [PubMed 14598172]). SLC25A22, also known as GC1, is 1 of the 2 mitochondrial glutamate/H symporters, the other being SLC25A18 (MIM 609303).[supplied by OMIMSequence: RSEGYFGMYRGAAVNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLLKEMLAGCGAGTCQVIVTTPMEMLKIQLQDAGRIAAQRKILAAQGQLSAQGGAQPSVE
Additional Information
| SKU | 10288079 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21935 |
