SLC6A14, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SLC6A14, Each

$ 1,069.20
|
Details
SLC6A14 is a member of the Na( )- and Cl(-)-dependent neurotransmitter transporter family and transports both neutral and cationic amino acids in an Na( )- and Cl(-)-dependent manner.[supplied by OMIMSequence: FQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETG
Additional Information
SKU | 10286540 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB20176 |