SMCR7, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SMCR7, Each
$ 1,069.20
|
|
Details:
This gene encodes a protein of unknown function. The gene is located within the Smith-Magenis syndrome region on chromosome 17. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeqSequence: PPAALSQPVLPLAPSSSAPEGPAETDPEVTPQLSSPAPLCLTLQERLLAFERDRVTIPAAQVALAKQLAGDIALELQAYFRSKFPELPFGAFVPGGPLYDGLQAGAADHVRLL
Additional Information
| SKU | 10289804 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23926 |
