518-831-8000 sales@utechproducts.com

SMCR7, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SMCR7, Each

1,069.20

Details:

This gene encodes a protein of unknown function. The gene is located within the Smith-Magenis syndrome region on chromosome 17. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeqSequence: PPAALSQPVLPLAPSSSAPEGPAETDPEVTPQLSSPAPLCLTLQERLLAFERDRVTIPAAQVALAKQLAGDIALELQAYFRSKFPELPFGAFVPGGPLYDGLQAGAADHVRLL

Additional Information

SKU 10289804
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23926