SNRPD1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SNRPD1, Each
$ 945.60
|
Details
This gene encodes a small nuclear ribonucleoprotein that belongs to the SNRNP core protein family. The protein may act as a charged protein scaffold to promote SNRNP assembly or strengthen SNRNP-SNRNP interactions through nonspecific electrostatic contacts with RNA. [provided by RefSeqSequence: SMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGR
Additional Information
SKU | 10289402 |
---|---|
UOM | Each |
UNSPSC | 12161500 |
Manufacturer Part Number | PAB23487 |
CAS Number | 64-17-5 |
HS Code | 2207100000 |
---|---|
UN Number | UN 1170 |
Proper Shipping Name | Ethanol |
Packaging Group | PG II |
Commodity Code | 526, 527 |
DG or HZ | DG |
Hazardous Class | 3 |
Label | |
Molecular Formula | C2H6O |
EC Number | 200-578-6 |
HIN | 33 |
Hazard Statement | H225-H319 |
Precautionary Statements | P280a-P303+P361+P353-P405-P501a-P210-P280-P305+P351+P338-P337+P313-P403+P235-P370+P378-P308+P311-P260-P301+P310-P311 |
Risk Statements | 11-10-36/37/38-39/23/24/25-23/24/25-68/20/21/22-20/21/22-52/53-51/53 |
GHS | GHS02,GHS07 |
GHS (Pictogram) | |
Safety Statements | 16-7-36-26-45-36/37-61-24/25-2017/7/16 |
Hazard Code | F,T,Xn,N |
Signal Word | Danger |