518-831-8000 sales@utechproducts.com

Sox7 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Sox7, Each

$ 1,757.70

Details

This gene encodes a member of the sox (sry-related hmg-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may play a role in tumorigenesis. A similar protein in mice is involved in the regulation of the wingless-type mmtv integration site family (wnt) pathway. [Provided by refseqsequence: splhcshplgslalgqspgvsmmspvpgcppspayyspatyhplhsnlqahlgqlspppehpgfdaldqlsqvellgdmdrnefdqylntpghpdsatgamalsghvpvsqvtptgptetslisvladatatyynsys

Additional Information

SKU 10286799
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20470