SPANXN4, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SPANXN4, Each
$ 1,757.70
|
|
Details:
This gene represents one of several duplicated family members that are located on the X chromosome. This gene family encodes proteins that play a role in spermiogenesis. These proteins represent a specific subgroup of cancer/testis-associated antigens, and they may be candidates for tumor vaccines. This family member belongs to a subgroup of related genes that are present in all primates and rats and mice, and thus, it represents one of the ancestral family members. [provided by RefSeqSequence: KEKGDLDISAGSPQDGEEEKDLVFLGARACLEEHIRRSVLYVGDSDTLSKMKTSESPPSGHIPQSGVFCNSPNAV
Additional Information
| SKU | 10290116 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB24443 |
