518-831-8000 sales@utechproducts.com

Sparc Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Sparc, Each

$ 1,757.70

Details

Secreted protein acidic and rich in cysteine/osteonectin/bm40, or sparc, is a matrix-associated protein that elicits changes in cell shape, inhibits cell-cycle progression, and influences the synthesis of extracellular matrix (ecm) (bradshaw et al., 2003 [Pubmed 12721366]).[Supplied by omimsequence: vlvtlyerdednnlltekqklrvkkihenekrleagdhpvellardfeknynmyifpvhwqfgqldqhpidgylshtelaplraplipmehcttrffetcdldndkyialdewagcfgikqkdidkdl

Additional Information

SKU 10292468
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28625