518-831-8000 sales@utechproducts.com

SSR3, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SSR3, Each

1,069.20

Details

The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR is comprised of four membrane proteins/subunits: alpha, beta, gamma, and delta. The first two are glycosylated subunits and the latter two are nonglycosylated subunits. The protein encoded by this gene is the gamma subunit and is predicted to span the membrane four times. [provided by RefSeqSequence: VLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEA

Additional Information

SKU 10287061
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20781