518-831-8000 sales@utechproducts.com

Ston2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ston2, Each

$ 1,757.70

Details

Endocytosis of cell surface proteins requires a dynamic complex of proteins that assemble on the inner surface of the plasma membrane. Stonin-2 is a component of the endocytic machinery that likely regulates vesicle endocytosis.[Supplied by omimsequence: rtpsvteappwratnpflnetlqdvqpspinpfsaffeeqerrsqnssissttgksqrdsliviyqdaisfddssktqshsdaveklkqlqiddpdhfgsatlpdddpvawieldahppgsarsqprdgwpmmlripek

Additional Information

SKU 10286526
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20161