518-831-8000 sales@utechproducts.com

Sult4a1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Sult4a1, Each

$ 1,757.70

Details

This gene encodes a member of the sulfotransferase family. The encoded protein is a brain-specific sulfotransferase believed to be involved in the metabolism of neurotransmitters. Polymorphisms in this gene may be associated with susceptibility to schizophrenia. [Provided by refseqsequence: gefeskyfefhgvrlppfcrgkmeeianfpvrpsdvwivtypksgtsllqevvylvsqgadpdeiglmnideqlpvleypqpgldiikeltsprlikshlpyrflpsdlhngdskviymarnpkdlvvsyyqfhrsl

Additional Information

SKU 10292574
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28739