518-831-8000 sales@utechproducts.com

Sumf1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Sumf1, Each

$ 1,757.70

Details

This gene encodes an enzyme that catalyzes the hydrolysis of sulfate esters by oxidizing a cysteine residue in the substrate sulfatase to an active site 3-oxoalanine residue, which is also known as c-alpha-formylglycine. Mutations in this gene cause multiple sulfatase deficiency, a lysosomal storage disorder. Alternative splicing results in multiple transcript variants. [Provided by refseqsequence: mdayevsntefekfvnstgylteaekfgdsfvfegmlseqvktniqqavaaapwwlpvkganwrhpegpdstilhr

Additional Information

SKU 10289159
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23205