SYT12, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SYT12, Each
$ 1,069.20
|
|
Details:
The SRG1 gene encodes a protein that is a member of a family of proteins involved in the regulation of transmitter release in the nervous system (Fernandez-Chacon et al., 2001 [PubMed 11242035]). The membrane-associated synaptic SRG1 protein is under thyroid hormone control during brain development (Thompson, 1996 [PubMed 8987811]).[supplied by OMIMSequence: LLSLSYLPTAERLTVVVVKAKNLIWTNDKTTADPFVKVYLLQDGRKMSKKKTAVKRDDPNPVFNEAMIFSVPAIVLQDLSLRVTVAESSSDGRGDNVGHVIIGPSASGMGTTHWNQMLATLRRPVSMWHAV
Additional Information
| SKU | 10286845 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20524 |
