518-831-8000 sales@utechproducts.com

Thsd1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Thsd1, Each

$ 1,757.70

Details

The protein encoded by this gene contains a type 1 thrombospondin domain, which is found in a number of proteins involved in the complement pathway, as well as in extracellular matrix proteins. Alternatively spliced transcript variants encoding different isoforms have been observed for this gene. [Provided by refseqsequence: vppeddasgsesfqsnaqkiipplfsyrlaqqqlkemkkkgltettkvyhvsqspltdtaidaapsapldlespeeaaankfrikspfpeqpavsagerppsrldlnvtq

Additional Information

SKU 10286917
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20606