TMC2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant TMC2, Each
$ 1,347.30
|
|
Details:
This gene is considered a member of a gene family predicted to encode transmembrane proteins. The specific function of this gene is unknown; however, expression in the inner ear suggests that it may be crucial for normal auditory function. Mutations in this gene may underlie hereditary disorders of balance and hearing. [provided by RefSeqSequence: QVLREVEKSHKSVKGKATARDSEDTPKSSSKNATQLQLTKEETTPPSASQSQAMDKKAQGPGTSNSASRT
Additional Information
| SKU | 10290166 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB24497 |
