518-831-8000 sales@utechproducts.com

TMC2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant TMC2, Each

1,347.30

Details

This gene is considered a member of a gene family predicted to encode transmembrane proteins. The specific function of this gene is unknown; however, expression in the inner ear suggests that it may be crucial for normal auditory function. Mutations in this gene may underlie hereditary disorders of balance and hearing. [provided by RefSeqSequence: QVLREVEKSHKSVKGKATARDSEDTPKSSSKNATQLQLTKEETTPPSASQSQAMDKKAQGPGTSNSASRT

Additional Information

SKU 10290166
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24497