518-831-8000 sales@utechproducts.com

Tomm22, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Tomm22, Each

$ 1,621.74

Details

The protein encoded by this gene is an integral membrane protein of the mitochondrial outer membrane. The encoded protein interacts with tomm20 and tomm40, and forms a complex with several other proteins to import cytosolic preproteins into the mitochondrion. [Provided by refseqsequence: maaavaaagagepqspdellpkgdaekpeeeleedddeeldetlserlwgltemfpervrsaagatfdlslfvaqk

Additional Information

SKU 10292479
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28636