518-831-8000 sales@utechproducts.com

TPCN1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant TPCN1, Each

1,757.70

Details:

Voltage-gated Ca(2 ) and Na channels have 4 homologous domains, each containing 6 transmembrane segments, S1 to S6. TPCN1 is similar to these channels, but it has only 2 domains containing S1 to S6 (Ishibashi et al., 2000 [PubMed 10753632]).[supplied by OMIMSequence: FKSLLLHKRTAIQHAYRLLISQRRPAGISYRQFEGLMRFYKPRMSARERYLTFKALNQNNTPLLSLKDFYDIYEVAALKWKAKKNREHWFDELPRT

Additional Information

SKU 10289482
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23577